PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3501s0157.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 364aa    MW: 41940.8 Da    PI: 7.056
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3501s0157.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix859.5e-2788169286
             trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          W ++e++ Li +rr m+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k +++++    s +++y++++e
  Cagra.3501s0157.2.p  88 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKYHDRGN---GSAKMSYYKEIE 169
                          ********************************************************************84...566899***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-478149IPR009057Homeodomain-like
PROSITE profilePS500907.97980144IPR017877Myb-like domain
SMARTSM007170.009684146IPR001005SANT/Myb domain
CDDcd122031.46E-2986151No hitNo description
PfamPF138373.5E-2087170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MFISDKSRPT DFYKDDNPNS STAATRDMMI DVTTPNEAVV DLQPHHHHHH HHNHNHHLHQ  60
SQPQQILLGD SSSEDHEVKA PKKRAETWVQ DETRSLIMFR RGMDGLFNTS KSNKHLWEQI  120
SAKMREKGFD RSPTMCTDKW RNLLKEFKKA KYHDRGNGSA KMSYYKEIED ILRERSKKVT  180
TTQYNKSPST PPPTTAKVDS FMQFSDKGFD DTSISFGSVE GGDGHGQPFG GRVITVKFGD  240
YTRRIGIDGS CEAIKEAIRS AFGLRTRRAF WLEDEDQIVR SLDREMPLGN YLLHLDDGLA  300
IRVCHYDESN QLPVHSEEKI FYTEEDYRDF LARRGWTCLQ VDGFRNIENM DDLQPGAVYR  360
GVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A1e-5582167186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0119790.0BT011979.1 Arabidopsis thaliana At1g13450 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307687.10.0hypothetical protein CARUB_v10009313mg
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLR0IPF90.0R0IPF9_9BRAS; Uncharacterized protein
STRINGscaffold_101505.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.20.0Trihelix family protein